Protein Info for GFF2443 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 74 to 99 (26 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 244 to 272 (29 residues), see Phobius details amino acids 292 to 316 (25 residues), see Phobius details PF03824: NicO" amino acids 73 to 179 (107 residues), 74.2 bits, see alignment E=5.7e-25 amino acids 186 to 312 (127 residues), 53.9 bits, see alignment E=9.2e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to stm:STM2551)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>GFF2443 putative membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSVIFSQRTPGRRWLSLWPLALFLLLMLVGGLWMWQAWPQVMLKSALWQRDVNQQLSALL
NAVATHPERAGGSLLLLSFMYGVLHALGPGHGKVVIATWLATHPSKLKSSIVLTLAAALL
QGLVAIGLVVGVLTVLQLPARQLHLSGFWLEKGSYALVGGLGILLCWRAIKRLRALLRKP
VFIAFTPRHVHHEKCGCGHQHLPTQEQLHSGDDWRARFMIVLSMGMRPCSGAIMVLLFSK
VIGVFSWGMASVLAMAAGTSLTITSLALLVHTFRALAVKLSGNKAPALWRQVGWSTLALA
GGGILLVAALVMWFSVPQPVGGLRPWRG