Protein Info for GFF2436 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 271 to 288 (18 residues), see Phobius details PF00892: EamA" amino acids 7 to 133 (127 residues), 43.6 bits, see alignment E=1.8e-15 amino acids 152 to 284 (133 residues), 40.4 bits, see alignment E=1.7e-14

Best Hits

Swiss-Prot: 43% identical to YDEK_BACSU: Uncharacterized transporter YdeK (ydeK) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 78% identity to xau:Xaut_2213)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>GFF2436 hypothetical protein (Xanthobacter sp. DMC5)
MDRRLALGLLLGFVAVVMFGATLPLTRFALHDFSPWFISFGRAALAGFAALGLVLVMRRP
WPFGQRAVLWRLAVSSGCLIFVFPLAIGVATQTVPAAHGGIVLGLLPLCTAIAAMLLAGE
RPGLGLFAASAVGAGLVVAFALRNGAGGALGMGDSLLFLGVIACAIGYAVSGGLARTMSG
WEVIAFMLILCLPVTLPLALLTFPWGGAGTVAGASWAALLYLGLFSQLIGFFFWNAGLAM
GGIARVGQMQLLQTFVTVGLAWPINGEVPDAETVAFAAGVALVVAVAQRTRSRPR