Protein Info for GFF2433 in Variovorax sp. SCN45

Annotation: Putative OMR family iron-siderophore receptor precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 816 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF07660: STN" amino acids 78 to 123 (46 residues), 30.7 bits, see alignment 3.3e-11 PF07715: Plug" amino acids 174 to 273 (100 residues), 68.1 bits, see alignment E=1.3e-22 TIGR01783: TonB-dependent siderophore receptor" amino acids 176 to 816 (641 residues), 355.2 bits, see alignment E=4e-110 PF00593: TonB_dep_Rec_b-barrel" amino acids 357 to 787 (431 residues), 161 bits, see alignment E=1.4e-50

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 61% identity to del:DelCs14_3498)

Predicted SEED Role

"Putative OMR family iron-siderophore receptor precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (816 amino acids)

>GFF2433 Putative OMR family iron-siderophore receptor precursor (Variovorax sp. SCN45)
MARRRPFPFDSQHITRAVRGALLAMACAAGTAGAQTVPAADASATQAGPRKAYSIAAGPL
DDALSSFAATAGVSITMPPALVQGRRSPGLQGSYAVREGFARLLAGSGLEAAGGAGGAYA
LRPSTSGEREGSADGTTLAPVTVTAEADRSGTTEGTGAYITPATAAATGLALAPRDTPQS
VTVLTRQQIEDQNMLSLGQAMKSVTGVFAVSSDTDRTDLYARGFYIDNYQYDGVPTTVTT
DFFGASNSDPLLYDRIEVVRGATGLLTGAGNPSASVNLVRKHADSKVFAGAASLGIGSWN
QRRATVDLSTPLTEDGRVRARLIGMAEQRDSFIDMYHGRKQVLYGVVDADLTPDTTLSVG
IDYQANRPTGSTWGGLPLVFADGTATDWRRSQTVGTPWTHWDATNTTVFANLVHRFDNGW
KVKANLSYRKSEQDAKLLYLYGDLDRLTGTGLGALPGFFEHAFRQSSIDLQATGPFELLG
RKHELVVGISNSQSRYVQAKHPQTDEVADAGNFYLWNGSYPEPTWGALKVSQIDKTRQTG
YYGAVRLSLADPLKLIVGGRQNSWRTRNAKAERSHDVFTPYAGLVYDLNASYSLYASYTD
IFQPQNYRDAAGAYLDPVTGKSYELGIKGEHLNGKLNTSFAVFRARQENVAQRDGTRLVP
NSVDNAYYGAKGVTSKGFEAQVSGELASGWNLSAGIARTLGREGNGDPINTAMPTTLVNV
FTTYRLPGRWHQLTIGGGVNWQNRTYYRYSVGDVAMRFQQNSVAVASLMARYAFNPKLSL
QLNIENLFNKKYYNNIDGQGYYGTPRNAVATLTYKF