Protein Info for GFF2432 in Variovorax sp. SCN45

Annotation: Fe2+-dicitrate sensor, membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 84 to 103 (20 residues), see Phobius details PF16220: DUF4880" amino acids 17 to 58 (42 residues), 54.8 bits, see alignment 6.9e-19 PF04773: FecR" amino acids 114 to 214 (101 residues), 75.1 bits, see alignment E=4.9e-25

Best Hits

Swiss-Prot: 41% identical to FECR_ECOLI: Protein FecR (fecR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 54% identity to mms:mma_3496)

Predicted SEED Role

"Fe2+-dicitrate sensor, membrane component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>GFF2432 Fe2+-dicitrate sensor, membrane component (Variovorax sp. SCN45)
MSASQAMVVVDEAVAMQAAQWFFLMQSGEATSADRMRWTQWREADPSHEAAWQRAEQVSR
KFGMLPGRLSMPTLGRTVRADRRVAVKTLALLLTAAPAGWLAWRVSPAREWLADHRTATG
ERRELRLPDGTRIQLNTATAVDLAYDAKLRLVRLRAGEILIDTAPDAVASSDPAYRPFVV
ETAQGRLKALGTRFVVRQHEDRRSHVAVLEGAVELRPDDARGLAMVLRAGEQAGFSDSAI
DAVTPVGPEADDWSRGVLRARNMRLQDFLAELGRYRPGVLRCDPAVADLRVSGVFQLNDT
GPVLDSLPQALPVDVLYRTRYWVTVVAPGG