Protein Info for GFF243 in Xanthobacter sp. DMC5

Annotation: Non-homologous end joining protein Ku

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02772: Ku protein" amino acids 4 to 259 (256 residues), 265.3 bits, see alignment E=2.9e-83 PF02735: Ku" amino acids 14 to 193 (180 residues), 128.7 bits, see alignment E=1.3e-41

Best Hits

Swiss-Prot: 68% identical to KU_AZOC5: Non-homologous end joining protein Ku (ku) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K10979, DNA end-binding protein Ku (inferred from 68% identity to azc:AZC_1005)

Predicted SEED Role

"Ku domain protein" in subsystem DNA Repair Base Excision

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF243 Non-homologous end joining protein Ku (Xanthobacter sp. DMC5)
MAPRASWKGFLTVGALSCAVGLYAAASTSERISLHMLSRKSGHRLRRQYVDEETGKPVET
EDQVRGYEVSKGEYITIEPEEAAAVLPDNDKTISIDAFLPCDGIDTVYLDRPYFLAPVDE
AAAEVFDLLKRGMAAQKVAALGEALLFRRVRKLLIRPSGESGALLASTLSFDYEVRSAEE
AFAEVPDVKITGEMRELATHIIKTKAGKFDPEAYQDRYETALAELVRAKMEGKPLPKAAP
RKEEKVVDLLAALRASAKASGGDGAGKKASAKAGKAAAKVPAKKPTARPATARKSTRKVS