Protein Info for GFF2427 in Sphingobium sp. HT1-2

Annotation: Phosphatidate cytidylyltransferase (EC 2.7.7.41)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 62 to 93 (32 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details PF01148: CTP_transf_1" amino acids 7 to 253 (247 residues), 193.3 bits, see alignment E=3.8e-61

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 82% identity to sch:Sphch_1333)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.41

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>GFF2427 Phosphatidate cytidylyltransferase (EC 2.7.7.41) (Sphingobium sp. HT1-2)
MSSELRTRTIVGLGLIAVAVGALVFGGFVFWMLLSIAGVLMMGEWGMLTGASSDQRKMAM
YAVSVPLAILCPVAAGVSWLGFGLMMASFFFVLITSRAIKLALGILYICLPVIALLFLRG
QAPDSHGLLLAFWALGLVWATDIGAYFAGRSIGGPKLAPRVSPSKTWSGLGGGVLAALLT
GFLLYRFADLPIQLAAASGLLAVAAQLGDLLESAMKRRAGVKDSSNLLPGHGGVMDRLDG
VVAAAPLAALLYLVLAGA