Protein Info for PS417_12365 in Pseudomonas simiae WCS417

Annotation: cobalt chelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF08907: DUF1853" amino acids 20 to 304 (285 residues), 345 bits, see alignment E=2.1e-107

Best Hits

KEGG orthology group: K09977, hypothetical protein (inferred from 95% identity to pfs:PFLU2673)

Predicted SEED Role

"FIG00953564: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UKG5 at UniProt or InterPro

Protein Sequence (315 amino acids)

>PS417_12365 cobalt chelatase (Pseudomonas simiae WCS417)
MTVFPDLHTLPRQLRHPEVRDLAWVMLAPPMLAHTPWPQRHPLAGSDWVQAPHQLERWLR
QLDQDSGALQQWLSLSRTRRLGLYYERLWQFAVQHAPGVELLAANLPIRRAGHTLGELDM
LLRDRDGVHHLELAIKLYLGPQDGNGQDTAQWLGPGCHDRLDRKLAHLAQHQLPISARAE
SREALAALDIQQFDAHLWLGGYLLYPWPGQAQAPVGAHPQHLRGRWLHQRDWQAFVSLSQ
PGRWQPLPRHAWLAPAHYPADQVWSEAQMQGWLADLDPMAQAQLLVRLVQVGEDWEEAER
LFLVADLWPNVPGAG