Protein Info for GFF2425 in Sphingobium sp. HT1-2

Annotation: Intramembrane protease RasP/YluC, implicated in cell division based on FtsL cleavage

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details PF02163: Peptidase_M50" amino acids 13 to 353 (341 residues), 242.4 bits, see alignment E=5.5e-76 TIGR00054: RIP metalloprotease RseP" amino acids 142 to 364 (223 residues), 168.4 bits, see alignment E=1.2e-53 PF00595: PDZ" amino acids 144 to 191 (48 residues), 29.8 bits, see alignment 9.8e-11 PF17820: PDZ_6" amino acids 147 to 196 (50 residues), 43.4 bits, see alignment 3.4e-15

Best Hits

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 89% identity to sjp:SJA_C1-24090)

Predicted SEED Role

"Membrane-associated zinc metalloprotease" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>GFF2425 Intramembrane protease RasP/YluC, implicated in cell division based on FtsL cleavage (Sphingobium sp. HT1-2)
LIHNPGFLLTILAFVAVIGPLVFVHELGHYLVGRWCGVKAEAFSIGFGPEIAAWVDRRGT
RWRLAALPLGGYVRFKGDMNAASQTDPKWLEMSAQDRAESFPAKPLWQRAAIVAAGPAIN
FLFAILILAAFAFLHGESRTPAVAGMVQPGSAAAMAGIQPGDRIVSLNGRAMSTFDDIRL
YAQIRPGEPVTILLDRKGQVIEKQGHVGAVSEDDGFGNKFRIGRLGIAPGEPVIEPVSLL
RAPVVAIERTGQIIRTMVETLGQVIGGDRSVKELGGPLKIAQVSGQAATLGLESFIFFIA
LISINLGFINLLPIPMLDGGHLLFYGVEAVQRRPVSPQVQDWAYRSGLALLMTVMLLVTF
NDLSSFGLWERLSGLIG