Protein Info for GFF2424 in Xanthobacter sp. DMC5

Annotation: putative RNA polymerase sigma factor FecI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF04542: Sigma70_r2" amino acids 20 to 81 (62 residues), 29.7 bits, see alignment E=6.6e-11 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 25 to 170 (146 residues), 65.2 bits, see alignment E=2.7e-22 PF08281: Sigma70_r4_2" amino acids 115 to 166 (52 residues), 47.4 bits, see alignment E=1.9e-16 PF04545: Sigma70_r4" amino acids 119 to 167 (49 residues), 33.8 bits, see alignment E=3e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 79% identity to azc:AZC_4431)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>GFF2424 putative RNA polymerase sigma factor FecI (Xanthobacter sp. DMC5)
MIAKTDPSSDLMLAYMRQWRDLRAHLCRRVGSRDLAEEALQETWLRLAGMGPAPVGVRDC
HAFLLRIAGNIAIDLLRRERRHAARQISDEAVLRGIADATPSPEAYALHRDELRVLVHAL
AELEQRPRAALLLSRCDGLTHAEIGARMKVSDSMVAKYLVQALRHCRDRLRALD