Protein Info for GFF2424 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Succinate dehydrogenase/fumarate reductase, flavoprotein subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 transmembrane" amino acids 168 to 185 (18 residues), see Phobius details PF01946: Thi4" amino acids 15 to 60 (46 residues), 27.9 bits, see alignment 4.2e-10 PF00890: FAD_binding_2" amino acids 16 to 554 (539 residues), 347.1 bits, see alignment E=5.4e-107 PF03486: HI0933_like" amino acids 16 to 58 (43 residues), 25.5 bits, see alignment 1.7e-09 PF01266: DAO" amino acids 16 to 306 (291 residues), 47.3 bits, see alignment E=6.7e-16 PF12831: FAD_oxidored" amino acids 16 to 66 (51 residues), 42.2 bits, see alignment 2.1e-14 PF13450: NAD_binding_8" amino acids 19 to 53 (35 residues), 26 bits, see alignment (E = 2.7e-09)

Best Hits

KEGG orthology group: None (inferred from 71% identity to pfl:PFL_2450)

Predicted SEED Role

"Succinate dehydrogenase/fumarate reductase, flavoprotein subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (581 amino acids)

>GFF2424 Succinate dehydrogenase/fumarate reductase, flavoprotein subunit (Hydrogenophaga sp. GW460-11-11-14-LB1)
VNNARTPIQEIPTACDVLVVGSGAAGLAAAVTAAWHGLRVIVVEKDSVFGGATSWSGGWM
WIPGNPLAQRAGIQENPAQPKTYLKNELGAYYDSARVDAFLAHGPRMVAFFETHTELQFV
DGNGIPDMHGETEGAATQGHQVIAAPYDGRMLGALLGRLRKTMRETSFMGMPIMAGADLA
AFLSVTRSLKSAVHVARRLSRHLLDLGRYGRSTQLVNGVALVGRLAKSADTLGVTLIESA
AAKELIVHSGCVTGAVVEWAGGTVQIQAARGVVLASGGFPHDVERRRKLFPRTPTGREHL
ALPPEACSGDGITLGEAAGGVFMTKLASPVAWAPVSRIHHPDGTVGHFPHIIDRAKPGVI
GVLANGQRFVNEAGGYYDYTSAMVANAAEGSEVASWLICDHRFQRRYGLGFSKPFPLSIK
AQLRSGYLLRADTIGELARRCGIDEDGLKNTVAYFNEHARRGEDPLFQRGSTAFNRKGGD
PTQRPNPCIAPIEQGPFYAVKVLPGCFGTFAGLNTNGAAQVLDDGGAPIPGLYAAGADMA
SVMGGRYPSGGINLGPAMTFGYIAGLHLAGELQKPQVDAHP