Protein Info for PS417_12355 in Pseudomonas simiae WCS417

Annotation: magnesium chelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF07728: AAA_5" amino acids 33 to 163 (131 residues), 53.9 bits, see alignment E=5.1e-18 PF00158: Sigma54_activat" amino acids 33 to 149 (117 residues), 25.6 bits, see alignment E=2.2e-09 PF00493: MCM" amino acids 34 to 156 (123 residues), 33.7 bits, see alignment E=5.1e-12 PF01078: Mg_chelatase" amino acids 81 to 150 (70 residues), 28.8 bits, see alignment E=2e-10 PF17863: AAA_lid_2" amino acids 228 to 289 (62 residues), 65.1 bits, see alignment E=1e-21

Best Hits

KEGG orthology group: K03405, magnesium chelatase subunit I [EC: 6.6.1.1] (inferred from 93% identity to pfs:PFLU2671)

Predicted SEED Role

"ChlI component of cobalt chelatase involved in B12 biosynthesis" in subsystem Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U185 at UniProt or InterPro

Protein Sequence (332 amino acids)

>PS417_12355 magnesium chelatase (Pseudomonas simiae WCS417)
MTDIPHFPLSAVVGADDLKLALCLTAIDPKIGGVLIEGPRGMAKSTLARGLADLLASGQF
VTLPLGATEERLVGTLDLDAALGEGRAQFSPGVLAKADGGVLYVDEVNLLPDHLVDVLLD
VAASGTNLIERDGISHRHSARFVLIGTMNPEEGELRPQLLDRFGFNVALSGQTLPVERGQ
IIRRRLDFDSDPEAFCAQWDESQAALRERCTQARARLDAIALDDETLARITERCFAAGVD
GLRADLVWLRGARAHAAWRGAHAIGEEDIEAVAEFALRHRRQEQATLSSPPSEGQSPKSS
DASPGQGQWGDMPAPALPTGARREIPTWPKKP