Protein Info for PS417_12345 in Pseudomonas simiae WCS417

Annotation: cobalamin biosynthesis protein CobW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR02475: cobalamin biosynthesis protein CobW" amino acids 5 to 349 (345 residues), 526.8 bits, see alignment E=1e-162 PF02492: cobW" amino acids 8 to 215 (208 residues), 200.7 bits, see alignment E=1.6e-63 PF07683: CobW_C" amino acids 278 to 353 (76 residues), 61 bits, see alignment E=8.1e-21

Best Hits

Swiss-Prot: 79% identical to COBW_PSEAE: Protein CobW (cobW) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02234, cobalamin biosynthesis protein CobW (inferred from 98% identity to pfs:PFLU2669)

Predicted SEED Role

"CobW GTPase involved in cobalt insertion for B12 biosynthesis" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZ03 at UniProt or InterPro

Protein Sequence (355 amino acids)

>PS417_12345 cobalamin biosynthesis protein CobW (Pseudomonas simiae WCS417)
MKTLAKLPVTIVTGFLGSGKTTLLRHMLDNAQGRRIAVIVNEFGELGIDGEILKQCSIGC
TEEEANGRVYELANGCLCCTVQEEFFPVMRELVARRGDLDHILIETSGLALPKPLVQAFQ
WPEIRSACTVDAVITVVDSPAVAAGTFAAFPDQVDAQRKLDPNLDHESPLHELFADQLAS
ADLVILNKSDLISPEDLARVRLEVAEELPPAVKIIEASSGRLPLDVLIGLGAGSEEHIDG
RHSHHDHHHDGEDDHDHDHDAFDSISIDLPQADEALLLDGLTQLVVQHGILRVKGFAAIP
NKPMRLLIQGVGTRFDKHFDRAWGPDEARITRLVLIGQDLDAAGLEAQLRAALSV