Protein Info for GFF242 in Variovorax sp. SCN45

Annotation: Lipopolysaccharide export system permease protein LptG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 53 to 81 (29 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details amino acids 314 to 336 (23 residues), see Phobius details amino acids 345 to 368 (24 residues), see Phobius details TIGR04408: LPS export ABC transporter permease LptG" amino acids 3 to 365 (363 residues), 348.1 bits, see alignment E=2e-108 PF03739: LptF_LptG" amino acids 6 to 362 (357 residues), 224.5 bits, see alignment E=1.1e-70

Best Hits

KEGG orthology group: K11720, lipopolysaccharide export system permease protein (inferred from 86% identity to vpe:Varpa_2827)

Predicted SEED Role

"FIG000906: Predicted Permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>GFF242 Lipopolysaccharide export system permease protein LptG (Variovorax sp. SCN45)
VKTIRRLIYVEVLKSVAFVTLGFLSLFFFFDFVDELQSIGKPDSLNYGPMQALIYVALLI
PSHLYELLPITVLIGSIFVMARLAQSSEYTILRTSGLGPWRALRTLLLLGLSFVVLTFAI
GDYVAPTSERTGQLLKARYQGTYSLAGNTGAWLKEKRGDVSYAVNVLAIDRGGALKSPRI
FEFDDKGYIKTQTLAASARIGGDGHWILTDVDQQHYDTQGAADRAHIVSTKIPELNWPTS
LTAEMVSVALLRPDRMSTIDLFDYIRHLDANGQTAQRYEIEFWRKVFYPLSCLVMVVLAL
PFAYLHFRQAGITTYVFGGVMIGISFFLLNNVFGYLGNLGNWSPWLTAAAPGLIYSVMSL
TAFSWLVLRR