Protein Info for GFF2419 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Anaerobic dimethyl sulfoxide reductase chain A (EC 1.8.99.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 792 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details TIGR02166: anaerobic dimethyl sulfoxide reductase, A subunit, DmsA/YnfE family" amino acids 15 to 792 (778 residues), 1191.2 bits, see alignment E=0 PF04879: Molybdop_Fe4S4" amino acids 54 to 112 (59 residues), 30.8 bits, see alignment 3.4e-11 PF00384: Molybdopterin" amino acids 115 to 560 (446 residues), 183.2 bits, see alignment E=1.2e-57 PF01568: Molydop_binding" amino acids 673 to 784 (112 residues), 90 bits, see alignment E=1.5e-29

Best Hits

KEGG orthology group: K07306, anaerobic dimethyl sulfoxide reductase subunit A [EC: 1.8.99.-] (inferred from 100% identity to sed:SeD_A2900)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 1.8.99.-

Use Curated BLAST to search for 1.8.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (792 amino acids)

>GFF2419 Anaerobic dimethyl sulfoxide reductase chain A (EC 1.8.99.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKNIKSQGNGEQPAISRRHFIQASSALIALPFVSSPATAQARAVTATENRPAEKVVQTCS
TFDCGGKCDIRAHVSDGIVTRISTRPDNALDAQMPVMRACVRGRAYRKFVYHPDRLKYPM
KRVGKRGEGKFERISWDEATTLIADNLKSITEKYGPASRYVHVGTAVSGGTFSGDKMARR
LLNLTGGYLESYHSVSMGNTAAATPYTYGIAASGSSLDTLLDTKLVILWGHNPTETIFGH
TNYFLQKMKQNGTRFIVVDPRYSDTVSSLADQWIPLLPTTDNALMDAMMYVIISENLHDR
AFIARYAIGFDEDSMPEGVPANESLVAYLTGAKDGVVKSPEWAEKITHVPAQTIRQLARD
YANTKPAALIQGWGPQRHNCGERTARGSTLLATITGNVGIKGGWAAGYGGCANRKFAAGP
EMPDNPVKAKISVMNWVQAADDASKVTPDMGLKDADKLDSNIRILFSLAGNYLANQNPDL
HQAVRVLEDESKIQFIVASDLFMTPSAKYADLLLPETSFMERWNIGETWGTASYLILSEK
LIEPEFERRSDYDWLREVAAKLGIENEFSQGRDEKAWIEHIWEQTRLAMPDENLPDFATL
QKTRQHLFKSAPFIAFEDNIRDPENHPFPTPSGKIEIFSKRLYDMQHPEIPALSHYVPAH
EGPEDALAKDFPLQLITWKGKNRANSTQYANPWLIEVQQQTLWINPQDAQKRGITHGDMV
RIHNSRGICEIPAEVTPRIIPGVVAMQAGAWWQPDENGVDKGGCANVLSSARITALAKGN
SHQTMLVEVAKA