Protein Info for GFF2415 in Sphingobium sp. HT1-2

Annotation: Acetyl-coenzyme A carboxyl transferase alpha chain (EC 6.4.1.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 TIGR00513: acetyl-CoA carboxylase, carboxyl transferase, alpha subunit" amino acids 2 to 313 (312 residues), 407.3 bits, see alignment E=2.5e-126 PF03255: ACCA" amino acids 4 to 313 (310 residues), 468.1 bits, see alignment E=1.3e-144 PF01039: Carboxyl_trans" amino acids 96 to 251 (156 residues), 64.5 bits, see alignment E=8e-22

Best Hits

Swiss-Prot: 81% identical to ACCA_SPHWW: Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K01962, acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC: 6.4.1.2] (inferred from 91% identity to sch:Sphch_1321)

MetaCyc: 51% identical to acetyl-CoA carboxyltransferase subunit alpha (Escherichia coli K-12 substr. MG1655)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase alpha chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>GFF2415 Acetyl-coenzyme A carboxyl transferase alpha chain (EC 6.4.1.2) (Sphingobium sp. HT1-2)
MVSFLEFEKPVAELEARIIELRQTASVGDIDISGEINTLEQRADKMLSDIYAKLTPWQKT
QVARHPERPHFKDYVAGMFDNFMPLAGDRAFADDQAIIGGFATLGERKVMVIGHEKGDDT
ASRVRHNFGMAKPEGYRKAIRLMELADRFGLPVVTLVDTSGAFPGVQAEERGQAEAIARS
TEACLALGVPMVAAVVGEGGSGGAVALAAANRVLMFEHAVYSVISPEGCASILWRTADKA
SDAATAMQVTAQHLKGLGVIDRIVVEPVGGAHREPVQAIANLGAAIGEELDALSGLEPQA
LRTDRADKFLAIGI