Protein Info for GFF2412 in Xanthobacter sp. DMC5

Annotation: Putative non-heme bromoperoxidase BpoC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF00561: Abhydrolase_1" amino acids 20 to 249 (230 residues), 98.3 bits, see alignment E=8.7e-32 PF12697: Abhydrolase_6" amino acids 22 to 252 (231 residues), 72.7 bits, see alignment E=1e-23 PF12146: Hydrolase_4" amino acids 43 to 143 (101 residues), 39 bits, see alignment E=8.8e-14

Best Hits

KEGG orthology group: None (inferred from 85% identity to xau:Xaut_2294)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>GFF2412 Putative non-heme bromoperoxidase BpoC (Xanthobacter sp. DMC5)
MPTTHNDGLELAYQVSGEGPPLLIISGLSAERSFWALSRPLLTGFTLIEFDNRDIGKSQR
AKAAYTAADMARDALAVLDAAGFEKAHVIGHSMGGMIAQELAIAAPKRVNRLVLSNTIAR
NDLYTTEIMRLFKELRLQLDNELTFGAALTTFVLGMRTLNKIPLFAAVQQSLDAGLYQEK
DAFIRQVGVCVGFDSLARIGTITAPTLAIYCDDDRLFSPAMVREVANGIPGAKLDEIIDS
GHCPMVEAPENFCTTVRAFLNGS