Protein Info for GFF2411 in Xanthobacter sp. DMC5

Annotation: ATP-dependent protease subunit HslV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00227: Proteasome
  • amino acids 9 to 179 (171 residues), 75.6 bits, E=2.1e-25
• TIGR03692: ATP-dependent protease HslVU, peptidase subunit
  • amino acids 10 to 179 (170 residues), 270 bits, E=3.6e-85

Best Hits

Swiss-Prot: 80% identical to HSLV_BRASB: ATP-dependent protease subunit HslV (hslV) from Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 96% identity to xau:Xaut_2295)

MetaCyc: 59% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Protein Sequence (181 amino acids)

>GFF2411 ATP-dependent protease subunit HslV (Xanthobacter sp. DMC5)
MHSPDTIYGTTIVTVRKGNRVAIAGDGQVTLGQTVLKANARKVRRLGRGDVIGGFAGATA
DAFTLFERLEAKLEQYPGQLQRAAVELAKDWRTDRYLRRLEAMMIVADASVSLVLTGTGD
VLEPDAGVAGIGSGGMYALAAARALLDREEDPEAIVRRSLEIAADICVYTNRNIVVETIG
S