Protein Info for GFF2410 in Xanthobacter sp. DMC5

Annotation: ATP-dependent protease ATPase subunit HslU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 5 to 435 (431 residues), 605.6 bits, see alignment E=3e-186 PF07728: AAA_5" amino acids 52 to 88 (37 residues), 23.5 bits, see alignment 7.2e-09 PF00004: AAA" amino acids 53 to 99 (47 residues), 24.9 bits, see alignment 3.6e-09 amino acids 229 to 324 (96 residues), 30 bits, see alignment E=1e-10 PF07724: AAA_2" amino acids 182 to 321 (140 residues), 95.7 bits, see alignment E=4.9e-31

Best Hits

Swiss-Prot: 94% identical to HSLU_XANP2: ATP-dependent protease ATPase subunit HslU (hslU) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 94% identity to xau:Xaut_2296)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>GFF2410 ATP-dependent protease ATPase subunit HslU (Xanthobacter sp. DMC5)
MSDFSPREIVSELDRHIVGQGKAKRAVAIALRNRWRRQQLDEKLREEVLPKNILMIGPTG
VGKTEISRRLARLAGAPFLKVEATKFTEVGYVGRDVEQIVRDLLEVGIGLTRDAKRKDVQ
AKAHLAAENRVLDALVGATASQATRDAFRKRLRAGELDDKEVEIEVAQGQQGMPMFEIPG
MPGAQMGAISLGDMLGKAFGGRSKPRRVTVKEAHPLLLTEEADKLIDQEAITQEAIHAVE
NNGIVFLDEIDKIAGREGRSGADVSREGVQRDLLPLIEGTTVSTKHGSVKTDHILFIASG
AFHVSKPSDLLPELQGRLPIRVELEALTRADFVRILTETEASLVKQSVALMGTEGVTLDV
TADAVEAIADAAVEVNSNVENIGARRLQTVIERVLDDLSFSAPDRSGETVVVDAEYVRSR
VADLAKNADLSRFIL