Protein Info for GFF2408 in Sphingobium sp. HT1-2

Annotation: protein of unknown function DUF405

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 65 to 81 (17 residues), see Phobius details amino acids 101 to 133 (33 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 296 to 319 (24 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 366 to 383 (18 residues), see Phobius details PF04235: DUF418" amino acids 248 to 405 (158 residues), 126.8 bits, see alignment E=3.9e-41

Best Hits

KEGG orthology group: K07148, uncharacterized protein (inferred from 68% identity to sjp:SJA_C1-23920)

Predicted SEED Role

"protein of unknown function DUF405"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>GFF2408 protein of unknown function DUF405 (Sphingobium sp. HT1-2)
MTAASPRIPAMDVLRGCAVMGILWMNITAFALPQNAYFNPVAAGPMSAGDIAFWASSLIL
VDGKMRGLFSLLFGASMLLLIDREEMAGRDGTRTQLVRGGWLLAIGLLHHILLWWGDILV
TYAVVGTIALLFAQKEPLALVKWAFLAFLIHFLICGAFIASLYGWAHAAAAPDAAAATRE
GLDSFLAGLSDPSSPIIQQDIAIYTGSFGGIVRHHLTGFVGDWLWTFLFTGLDTLGFMLL
GMAMLKGGFLIGRWPAEQYRQTARHCFLIGLVPMIGLTIWVVASGFAPLTAFSTALLWSF
PFRIPLAVGWAALILWLLARHRDHWLVGRIAATGRMALSNYLGTSLVMTAIFYGWGLGLF
GQMRPAAFPLFLIAAWAVMLLWSKPWLDRFAMGPAEWLWRSLQRGKLQKIRRSA