Protein Info for GFF2407 in Sphingobium sp. HT1-2

Annotation: Malonyl-[acyl-carrier protein] O-methyltransferase (EC 2.1.1.197)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF13489: Methyltransf_23" amino acids 35 to 189 (155 residues), 65.1 bits, see alignment E=2e-21 PF01209: Ubie_methyltran" amino acids 41 to 149 (109 residues), 26.1 bits, see alignment E=1.6e-09 PF13847: Methyltransf_31" amino acids 52 to 152 (101 residues), 34.5 bits, see alignment E=5.2e-12 PF13649: Methyltransf_25" amino acids 53 to 144 (92 residues), 66.9 bits, see alignment E=6.3e-22 PF08241: Methyltransf_11" amino acids 54 to 148 (95 residues), 66.6 bits, see alignment E=7.6e-22 PF08242: Methyltransf_12" amino acids 54 to 146 (93 residues), 60.4 bits, see alignment E=7.1e-20

Best Hits

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 75% identity to sjp:SJA_C1-23910)

Predicted SEED Role

"Biotin synthesis protein BioC / Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.3.3

Use Curated BLAST to search for 6.3.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>GFF2407 Malonyl-[acyl-carrier protein] O-methyltransferase (EC 2.1.1.197) (Sphingobium sp. HT1-2)
MRLPMNQVRKQRISESFGAAADRYDEHAGPQRTAAALVADIAQRQSPEGVARILEIGCGT
GLLTRDIQARWPGADLVATDISPKMLDRAASAGLVAGTFLAMDGEAPSFEGEWFDLILSS
LAFQWFDDLPAAIARLVALLRPGGSLIFSTMGQGSFAQWRAAHAACDLTPGVPAYPSLDA
LRAMLAAYGDAFAFDETVLLDGQGARALIGHLKGIGAVVPDEGRRPLSPAALRRVMAAYD
EAGGRDVYQLLIGRVTRADQA