Protein Info for GFF2406 in Variovorax sp. SCN45

Annotation: DipZ protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 64 (25 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 128 to 154 (27 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details PF00578: AhpC-TSA" amino acids 318 to 421 (104 residues), 45.3 bits, see alignment E=1.6e-15 PF08534: Redoxin" amino acids 318 to 428 (111 residues), 46.2 bits, see alignment E=8.8e-16 PF13905: Thioredoxin_8" amino acids 324 to 419 (96 residues), 30.2 bits, see alignment E=9.2e-11 PF17991: Thioredoxin_10" amino acids 471 to 617 (147 residues), 181.6 bits, see alignment E=2.5e-57

Best Hits

KEGG orthology group: None (inferred from 66% identity to bxe:Bxe_B0816)

Predicted SEED Role

"DipZ protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (617 amino acids)

>GFF2406 DipZ protein (Variovorax sp. SCN45)
MLLFVVAYLGGVLTILSPCILPVLPFVFARGDQPFLKSGLPLLLGMALTFAGVASLAAVG
GGWAVQANQYGRIVAIVLMALFGVTLLFPQLAERLTRPLVNWGERLSASAGGNGGEAQGG
RSSFVTSVLLGVATGLLWAPCAGPILGLVLTGAALGGASAQTSLLLLAYAAGAATSLAGA
LLVGGRLFKAMKKSLGAGEWIRRGIGVALLCGVAAIALGLDTGVLAQLSLSSTSSVEQAL
IDKVRPKKPAESVADAPIVTTGPDSTVMMAGSNAMMASNNAMMAAADGNKGAAAPLPVEG
PSPSLDGAVQWLNSPPLTMEGLRGKVVLIDFWTYSCINCLRALPYVEAWAKNYQDKGLVV
IGVHAPEFAFEKDIGNVRKAVADLKVDYPVAIDNNYAIWRAFKNEYWPAHYFIDAQGRIR
HHHFGEGEYDKSEQVIQQLLAEAGQASMPGEFVKVDAQGAQAAADSANVKSPETYIGYER
AENFASTGGLVRGKPHAYAVPGQLATNQWALGGDWTVGEQSAVLGKAQGRIAYRFHARDL
HLVLGSSADGRPVRIKVTIDGKPPGEDHGMDVDAQGNGTVSGQRLYQLVRQRGTVADRRF
EIEFLDPGAEAFAFTFG