Protein Info for PS417_12245 in Pseudomonas simiae WCS417

Annotation: GNAT family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF00583: Acetyltransf_1" amino acids 60 to 154 (95 residues), 70.3 bits, see alignment E=2.7e-23 PF13673: Acetyltransf_10" amino acids 60 to 156 (97 residues), 32.4 bits, see alignment E=1.3e-11 PF13508: Acetyltransf_7" amino acids 72 to 155 (84 residues), 45.8 bits, see alignment E=9.8e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2648)

Predicted SEED Role

"Streptothricin acetyltransferase, Streptomyces lavendulae type" in subsystem Streptothricin resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TM38 at UniProt or InterPro

Protein Sequence (184 amino acids)

>PS417_12245 GNAT family acetyltransferase (Pseudomonas simiae WCS417)
MNPKYPGLSVRVADEGFDAYVWGNDFSFEVSAYGEPQMGKRVDQWPVERILPYRKCYGID
PEEFASFRDAPDSAIFMAYLDDRPVGHIVVSTNWNGFAHVDELAVALPARRHGVAKALLD
VAQFWSRKKNLPGMMLETQNNNLGACRLYERCGYVMGGVDHLRYRGIDPQTREVAIFWYR
LFKV