Protein Info for GFF24 in Variovorax sp. SCN45

Annotation: VgrG protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 780 TIGR03361: type VI secretion system Vgr family protein" amino acids 6 to 516 (511 residues), 612.3 bits, see alignment E=6.9e-188 TIGR01646: Rhs element Vgr protein" amino acids 20 to 500 (481 residues), 463.8 bits, see alignment E=7.7e-143 PF05954: Phage_GPD" amino acids 24 to 325 (302 residues), 332.2 bits, see alignment E=4.2e-103 PF04717: Phage_base_V" amino acids 379 to 447 (69 residues), 51.7 bits, see alignment E=1.4e-17 PF22178: Gp5_trimer_C" amino acids 464 to 572 (109 residues), 82.4 bits, see alignment E=4e-27

Best Hits

KEGG orthology group: None (inferred from 84% identity to vpe:Varpa_2896)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (780 amino acids)

>GFF24 VgrG protein (Variovorax sp. SCN45)
MPRTVQVHTVLGAEQLKFRAMRGQEGLSQLFEFEVDMVGTSFNIELKQLLGTSLTLELAD
DGGPRFLNGTVVRFELVGRANETGRHYIYRALVQPWLWYLTRTTDCRIFQNKSVPEVLDE
VLGKYGFEFEKRLTASYRPWENCVQYQESDFAFVSRLMEHEGIAYHFEHGNGTHLLVLSD
DTGGYSPLPGHATIAYRPRDRVLNAMEPCIDQWRVSEQITSGRVMLDDFDFKKSRASLQS
VQQDPKGHDHSTYEVYEWLGGYSEHQQGDAYAKIRLQELQCAHELARGHTNVVGMAPGYL
FQMTHCPREADNREYLVTETRYDLQEPEYSSGGSSESVCEFDFTVLPSSVAYRPARNTPR
PRTNGPQTATVVGPEEIWTDRFGRVKLQFRWDRYGQGDENSSCWVRVSSSWAGANFGTMH
MPRVGQEVIVDFIGGEPDRPIITGRVYNSDQMPPWELPANATASGILTRSSSGGAANQAN
MLRFEDRTGSEQIWLHAERNLDVEVEADETHTTDGTRTTLIKGHESATYQDGETRDITAG
ARETITGGDTRDVTGGFTETVSGGVNQTISGGKTRMLSGGLQDTITGGVNSAISGGYHGT
IDGQEVRFVSAGRQDTIDTSNTVLVNGPSTTTVTGPTVHTSPDVTFNTTNHIHNTTQHVI
NTTVYNTTSNTYNNLAVSYTNNSVSYTNNYAKSSDWRLTRSGGAGFRFGAVGMSLDFWGV
RQQFYGINSQYAVLKVDFLTYKIANKGIDITNQAMEVGRTAVRFYMDGMAAYAQAMHLVM