Protein Info for GFF2398 in Variovorax sp. SCN45

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details amino acids 406 to 427 (22 residues), see Phobius details amino acids 439 to 460 (22 residues), see Phobius details PF07690: MFS_1" amino acids 40 to 422 (383 residues), 130.2 bits, see alignment E=1.3e-41 PF03137: OATP" amino acids 122 to 367 (246 residues), 50.3 bits, see alignment E=1.9e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>GFF2398 Uncharacterized MFS-type transporter (Variovorax sp. SCN45)
MSSLNPLAASLPPDATGPAAQETTRKAPSSAWYALAVLVIATVLGSIDKVILTLLTEPMR
ITLSLSDTQLGLLQGAGIVLFTGIATLPLGWLSDRYDRRVVLAACVLLWSAATAMRGTAM
DYGVLFIASIGLGVGEAGLTPITNSMIPDLFPRAQRVLANAVFALSAIFGSALGALLGGT
VVHLTDDLRHWLPASMQHLEAWRLTFFVMASAGIPVALLVLSIRKTRRGGAQPVSPAAGT
TPDAALPAPLQADADDAHSTVSFREHLRMHWRTFAGLVIGAGLASIGMSSIGTWLPIMAA
RQYGITPAQMGQGMGVAFLCGTVIGGLLGVAAMRYVQPRMGPAAALRIIMLGNLTAALLS
SLLLFTRSATDAFTLLALLVVPLISGAVLLPNVLQDAAPPHLRARTIALLSVAGLPFGVL
GPLVVGMLSDALKSVPNGLAVSIVATTLIGGVMGAMVLRATEGPFVRLMRAARPT