Protein Info for PS417_12220 in Pseudomonas simiae WCS417

Annotation: hydroxyacylglutathione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 TIGR03413: hydroxyacylglutathione hydrolase" amino acids 4 to 255 (252 residues), 346.7 bits, see alignment E=3.4e-108 PF00753: Lactamase_B" amino acids 14 to 167 (154 residues), 66.1 bits, see alignment E=4.4e-22 PF16123: HAGH_C" amino acids 168 to 255 (88 residues), 99.2 bits, see alignment E=1.4e-32

Best Hits

Swiss-Prot: 91% identical to GLO2_PSEFS: Hydroxyacylglutathione hydrolase (gloB) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 91% identity to pfs:PFLU2643)

MetaCyc: 47% identical to hydroxyacylglutathione hydrolase GloB (Escherichia coli K-12 substr. MG1655)
Hydroxyacylglutathione hydrolase. [EC: 3.1.2.6]

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UB83 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PS417_12220 hydroxyacylglutathione hydrolase (Pseudomonas simiae WCS417)
MIQISALPAFTDNYIWLLQDPSTQRCAVVDPGDAAPVLAWLKQNPEWALSDILITHHHHD
HVGGVEHLKRVTDAKVYGPANEKIPARDVALNDNDRISVLGWDFDIYTVPGHTLGHIAFY
HLGVLFCGDTLFAAGCGRLFEGTPAQMHTSLESLAALPADTLVYCTHEYTQSNLKFAQAV
EPDNADIAQRVEIVRQLRERGEITLPSNLALEKRTNPFLRTSETSVKQKADERSGRDNRS
GAEVFASLRAWKDKF