Protein Info for GFF2388 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Large-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01741: MscL
  • amino acids 3 to 131 (129 residues), 158.6 bits, E=4.5e-51
• TIGR00220: large conductance mechanosensitive channel protein
  • amino acids 3 to 133 (131 residues), 196 bits, E=1.1e-62

Best Hits

Swiss-Prot: 100% identical to MSCL_SALHS: Large-conductance mechanosensitive channel (mscL) from Salmonella heidelberg (strain SL476)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 99% identity to sei:SPC_3479)

MetaCyc: 91% identical to large conductance mechanosensitive channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Protein Sequence (137 amino acids)

>GFF2388 Large-conductance mechanosensitive channel (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT
LREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEE
VLLGEIRDLLKEQNNRS