Protein Info for GFF2385 in Xanthobacter sp. DMC5

Annotation: Sulfate transport system permease protein CysT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 138 to 162 (25 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 12 to 273 (262 residues), 307.3 bits, see alignment E=1e-95 TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 15 to 277 (263 residues), 394.7 bits, see alignment E=2.1e-122 PF00528: BPD_transp_1" amino acids 83 to 277 (195 residues), 66.1 bits, see alignment E=1.7e-22

Best Hits

Swiss-Prot: 52% identical to CYST_SYNE7: Sulfate transport system permease protein CysT (cysT) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 91% identity to xau:Xaut_1393)

MetaCyc: 51% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>GFF2385 Sulfate transport system permease protein CysT (Xanthobacter sp. DMC5)
MSASSSRLTFRQPSVIPGFGLTLGLTLTWLGLIVLLPLSALFIKTSELSLERFIAIVTAT
RTLHALQVSFGLAFGAALINMVFGAIVVWVLVRYDFPGKKVVDALIDIPFALPTAVAGIA
LTSLYAENGWVGSLLAPLGIQVSFTPLGILVALVFIGLPFVVRTVQPVLADLDQELEDAA
ASLGATRTQALVRVVLPSVWPALLTGFALAFARAVGEYGSVIFIAGNLPGVSEIAPLLIV
IRLEEFRYADATAIATVMLVASFVLLLIINRLQRWAELRGSKHG