Protein Info for GFF2385 in Pseudomonas sp. DMC3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 207 to 231 (25 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 262 to 279 (18 residues), see Phobius details PF00892: EamA" amino acids 10 to 136 (127 residues), 53.1 bits, see alignment E=2.1e-18 amino acids 148 to 278 (131 residues), 63.2 bits, see alignment E=1.6e-21

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfo:Pfl01_1473)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>GFF2385 hypothetical protein (Pseudomonas sp. DMC3)
MTPRTALGALHIGALMFGLTGVFGKLAAASPAVIVFGRAAFAVLALAFFARFASQHGWQK
LQAVDWRRLALSGVLLAGHWVSFFVSVKIAGVAIATLGFASFPAFTVILEGLIFRERIRP
NEIVLVVLVSIGLVLVTPAFDLGSGATVGLLWAVLSGLLFSLLSLTNRASSGRIPAVQAA
LCQNVVVALCLLPVAAPQLSQVRALDWLWIALLGVFCTGVAHSLFVASLAVIKARTAAVV
FAMEPVYGITIAWLLFSETPTLRMLIGGALIIVAIVVSARMSGSADKKTVAAEAASH