Protein Info for GFF2382 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: MSHA biogenesis protein MshM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 282 to 300 (19 residues), see Phobius details PF13191: AAA_16" amino acids 25 to 158 (134 residues), 38.4 bits, see alignment E=1.9e-13 PF13401: AAA_22" amino acids 42 to 173 (132 residues), 89.9 bits, see alignment E=1.8e-29

Best Hits

KEGG orthology group: K12283, MSHA biogenesis protein MshM (inferred from 59% identity to mmb:Mmol_1208)

Predicted SEED Role

"MSHA biogenesis protein MshM" in subsystem Mannose-sensitive hemagglutinin type 4 pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>GFF2382 MSHA biogenesis protein MshM (Hydrogenophaga sp. GW460-11-11-14-LB1)
MYLEHFGLQAFPFSITPSTQFFFSSETSQEALNTLLIAVSMGEGFMKITGEVGTGKTMLC
RKLLGALGEEYAVGYIFNPYLEPLALFIELAAELGLPRPVPEGMTQHEILNALTRRVLEL
NDSGKRVVICLDEAQAMPIETLEALRLLTNLETESRKLLQVIIFGQPELDERLNHPSVRQ
LRQRITFHYHLKPLSHSEFSYYVQHRLAAAGYRRGQLFTPLALWMLRRKSRCVPRLINVL
ANKAMMSAYGKGSRLVGLKEVVHAADDTDSVLGARPKRTASRLLGALVLAGVAVVAAWAY
RS