Protein Info for PS417_12140 in Pseudomonas simiae WCS417

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 831 TIGR00229: PAS domain S-box protein" amino acids 40 to 156 (117 residues), 24.4 bits, see alignment E=1.3e-09 amino acids 213 to 285 (73 residues), 29.7 bits, see alignment E=3.1e-11 amino acids 286 to 410 (125 residues), 49.2 bits, see alignment E=2.8e-17 PF08448: PAS_4" amino acids 47 to 152 (106 residues), 27.6 bits, see alignment E=1.2e-09 amino acids 297 to 404 (108 residues), 73.3 bits, see alignment E=7.4e-24 PF13426: PAS_9" amino acids 59 to 145 (87 residues), 17.4 bits, see alignment E=1.8e-06 amino acids 306 to 402 (97 residues), 27.4 bits, see alignment E=1.3e-09 PF08447: PAS_3" amino acids 187 to 271 (85 residues), 56.8 bits, see alignment E=8.8e-19 PF00989: PAS" amino acids 291 to 399 (109 residues), 32.5 bits, see alignment E=3.1e-11 PF00512: HisKA" amino acids 459 to 524 (66 residues), 36.9 bits, see alignment E=1.3e-12 PF02518: HATPase_c" amino acids 567 to 687 (121 residues), 71.7 bits, see alignment E=2.8e-23 PF00072: Response_reg" amino acids 713 to 823 (111 residues), 69.1 bits, see alignment E=1.5e-22

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU2626)

Predicted SEED Role

"Histidine kinase/response regulator hybrid protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYX5 at UniProt or InterPro

Protein Sequence (831 amino acids)

>PS417_12140 histidine kinase (Pseudomonas simiae WCS417)
MKGTSTVSEAAALIARLDWAQSPLGEANDWPQSLRTAVDIVVHSPMPMLLLWGDQLTQLY
NDGFAQLAGNKHPAAMGQPAHQTWPELESFTAPVYDAVLSGQVRTFSEQRFVLQRNNRDM
EIWLDLTYSPIRDESTRVAGILVTAIETNERRKAQHNTEQRLQLALAATDAVGTWDWDIG
EDRFIADAHFAYLHGVDPSDARLLPISDYLHGVHPEDRGMVAGSIKHCITFGTEYAEEYR
LLLADGQVRWVFARGRCYKDHQGRPARFLGAALDLTERKHTEQALRQSQTELQLIINAMP
VLIGYVDHEQRFRLNNSAYLEWYGMTPQELYGKTIREVLGDEVYAGREDKIAAALKGKAC
SFMTITPHRDGRPRHALMKYLPRFSNDGSVNGFYIFVIDETERKLTEEALRHLNENLEER
VAQRTQALAEANQRLQNEMFERERAEDALRHAQKMEAVGQLTGGIAHDFNNMLTGIIGSL
DLMQRYIAAGRSDEIGRFTDAAVSSAHRAAALTHRLLAFSRRQSLDRRPLDPNQLVASLE
DLFRRTKGAHITLKVKLGHDIWPVNTDASQLENALLNLVINARDAMPDGGELLIETANSY
LDGTDITTLEPVKAGDYVMLGVCDNGTGMAPKILAKAFDPFFTTKPIGQGTGLGLSMIYG
FAQQSGGHVTIQSEPGQGTCVRLYLPRLYGTALESSLPPHLSEAPVALAGEAVVVVEDDP
AVRMLVVNVLDELGYTAHQAADARTALPLLESDLRVDLLVTDVGLPGMNGRQLAEIARQY
RPGLRVLFMTGYAEKAAERQGFLEDGMDMVAKPFSIDLLATKIRSMISVEE