Protein Info for GFF2379 in Variovorax sp. SCN45

Annotation: Serine/threonine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF00069: Pkinase" amino acids 18 to 289 (272 residues), 132.7 bits, see alignment E=2.6e-42 PF07714: PK_Tyr_Ser-Thr" amino acids 78 to 283 (206 residues), 61.2 bits, see alignment E=1.5e-20 PF03109: ABC1" amino acids 107 to 190 (84 residues), 32.5 bits, see alignment E=7.8e-12

Best Hits

KEGG orthology group: K00924, [EC: 2.7.1.-] (inferred from 98% identity to vpe:Varpa_4959)

Predicted SEED Role

"Serine/threonine protein kinase (EC 2.7.11.1)" (EC 2.7.11.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.11.1

Use Curated BLAST to search for 2.7.1.- or 2.7.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>GFF2379 Serine/threonine protein kinase (Variovorax sp. SCN45)
MSKVKPSPLLPDTVIGGYRVVRRLSAGGFGVVYLAIDPAGQQVAIKEYLPSSLATRGPDE
LAPQVPPEKLSLYRLGLKSFFEEGRSLAQISHASVVSVLNFFRENETVYMVMNYLEGATL
QDFVVTARDLKKQKVFRESTIRSLFDEILRGLRIVHQYKMLHLDIKPANIFVTDDDRAVL
IDFGAAREVLSKEGIFIRPMYTPGFAAPEMYRRDSSMGPWTDIYAIGACIYACMQGYPPN
DAPRRIEKDRLSLSLSRLRGVYSDNLIEVVEWCMSLDPLSRPQSVFALQKELSREGERRY
TKLTVGEKVRLSIDNIRSFDKKSLPKAAAPTTRPA