Protein Info for PS417_12125 in Pseudomonas simiae WCS417

Updated annotation (from data): D-glucosaminate dehydratase (EC 4.3.1.9)
Rationale: Specifically important for: D-Glucosamine Hydrochloride. This enzyme had not previously been linked to a gene. This is the second step in catabolism of glucosamine, and the 'beta' form of the enzyme was expected to be PLP-dependent and about this size. Iwamoto et al (2003) purified a non-specific 'alpha' enzyme for this reaction (PMID: 12686150)
Original annotation: amino acid deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01168: Ala_racemase_N
  • amino acids 30 to 232 (203 residues), 38.6 bits, E=9.8e-14
• PF14031: D-ser_dehydrat
  • amino acids 289 to 384 (96 residues), 59.9 bits, E=3.1e-20

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfs:PFLU2623)

MetaCyc: 100% identical to glucosaminate ammonia-lyase (Pseudomonas simiae)
Glucosaminate ammonia-lyase. [EC: 4.3.1.9]

Predicted SEED Role

"D-serine deaminase (EC 4.3.1.18)" (EC 4.3.1.18)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• glycine betaine degradation III (7/7 steps found)
• D-serine degradation (3/3 steps found)
• L-serine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• glycine betaine degradation I (6/8 steps found)
• L-cysteine degradation II (2/3 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.18 or 4.3.1.9

Sequence Analysis Tools

See A0A1N7U313 at UniProt or InterPro

Protein Sequence (402 amino acids)

>PS417_12125 D-glucosaminate dehydratase (EC 4.3.1.9) (Pseudomonas simiae WCS417)
MSAINAVEKGAAAVGAHLVRDVSLPALVLHRDALEHNIRWMQDFVSNSGAELAPHGKTSM
MPALFQRQIEAGAWGITLANAVQTRAAYAGGVRRVLMANQLVGAPNMALIADLLADKDFD
FHCMVDHPDNVADLGLFFAARGLRLNVMIEYGVVGGRCGCRTEQEVRDLARAIKAQPALA
LTGIEGYEGVIHGEHAISGIRDFAASLVRLAVDLQNNGSFDLPKPIVTASGSAWYDLIAE
SFEQQNAAGRFLSVLRPGSYVAHDHGIYKEAQCCVLDRRSDLNEGLRPALEVWAHVQSLP
EPGFAVIALGKRDVAYDAGLPVPLKRYKAGILPAEGDDVTACKVTAVMDQHAFMTVAPGV
ELRIGDIISFGTSHPCLTFDKWQVGCLVDEQLQVIESLETRF