Protein Info for GFF2378 in Variovorax sp. SCN45

Annotation: UPF0701 protein YicC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF03755: YicC_N" amino acids 3 to 163 (161 residues), 105.2 bits, see alignment E=4.4e-34 TIGR00255: TIGR00255 family protein" amino acids 30 to 307 (278 residues), 215.9 bits, see alignment E=4.7e-68 PF08340: DUF1732" amino acids 224 to 307 (84 residues), 113.5 bits, see alignment E=3.7e-37

Best Hits

KEGG orthology group: None (inferred from 95% identity to vpe:Varpa_4960)

Predicted SEED Role

"Protein YicC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>GFF2378 UPF0701 protein YicC (Variovorax sp. SCN45)
MPVYSMTGYASGQNGSAGSHSEAESRPSAAGRLGVEIRSVNSRFLDLTFKLPEELRQHET
ALRELLTGKLKRGKVEVRAAIENTAQAGVVEPSVKLLQRLNGVQDSIKAWLPGARELSVA
DVLRLAGGDSAARGDWGPDLLEVTGKALDGLMSARQREGARLAKMLEAHLAQLRTLVQQA
GPLVPQLVEQQRTRFLERWKEAMGLTESTGGTLPEAAQDRALTEATAFAIRIDVAEELTR
LNSHLDEIERLLKKGGEIGKRLDFLIQELHREANTLGSKSAALELTRIGVDMKVLIEQMR
EQVQNIE