Protein Info for GFF2376 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: LSU ribosomal protein L18p (L5e)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 PF00861: Ribosomal_L18p" amino acids 2 to 117 (116 residues), 135.4 bits, see alignment E=5.8e-44 TIGR00060: ribosomal protein uL18" amino acids 3 to 117 (115 residues), 157.3 bits, see alignment E=8.8e-51

Best Hits

Swiss-Prot: 100% identical to RL18_SALPC: 50S ribosomal protein L18 (rplR) from Salmonella paratyphi C (strain RKS4594)

KEGG orthology group: K02881, large subunit ribosomal protein L18 (inferred from 99% identity to ebr:ECB_03155)

MetaCyc: 99% identical to 50S ribosomal subunit protein L18 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L18p (L5e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (117 amino acids)

>GFF2376 LSU ribosomal protein L18p (L5e) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDKKSARIRRATRARRKLKELGATRLVVHRTPRHIYAQVIAPNGSEVLVAASTVEKAIAE
QLKYTGNKDAAAAVGKAVAERALEKGIKDVSFDRSGFQYHGRVQALADAAREAGLQF