Protein Info for GFF2374 in Sphingobium sp. HT1-2

Annotation: P-hydroxybenzoate hydroxylase (EC 1.14.13.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02360: 4-hydroxybenzoate 3-monooxygenase" amino acids 1 to 390 (390 residues), 652.1 bits, see alignment E=1.3e-200 PF01494: FAD_binding_3" amino acids 3 to 343 (341 residues), 309.7 bits, see alignment E=3e-96 PF13450: NAD_binding_8" amino acids 7 to 37 (31 residues), 24.5 bits, see alignment (E = 2.8e-09)

Best Hits

Swiss-Prot: 60% identical to PHHY_PSEAE: p-hydroxybenzoate hydroxylase (pobA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00481, p-hydroxybenzoate 3-monooxygenase [EC: 1.14.13.2] (inferred from 78% identity to cse:Cseg_2348)

MetaCyc: 60% identical to p-hydroxybenzoate hydroxylase (Pseudomonas fluorescens)
4-hydroxybenzoate 3-monooxygenase. [EC: 1.14.13.2]

Predicted SEED Role

"P-hydroxybenzoate hydroxylase (EC 1.14.13.2)" in subsystem p-Hydroxybenzoate degradation (EC 1.14.13.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>GFF2374 P-hydroxybenzoate hydroxylase (EC 1.14.13.2) (Sphingobium sp. HT1-2)
MRTSIAIIGAGPAGMFLAHLLAAEGIAAVVLERRDRTYVEGRVRAGVLEQVTTDLMHRLG
LGGRLDREGLVHGGTQISLDGSLFRIDMTALTGGSAVTVYGQQEVMHDLFEAAPERGVEI
VWNAQDVTLEGLDGDHPVVRWRQDGVAQELQCDYVVGCDGYHGVSRNSIPAHVLRTFERV
YPFGWLGILADVPPADHELIYANHERGFALASMRSPTRSRYYIQCGLDEQVEDWSDDRFW
DELCLRLGPDAASRVTRGPSFEKSIAPLRSFVSEPMRWGRLFLAGDAAHIVPPTGAKGLN
LAASDVIMLSEALVDHYRGGSDAGLDGYSARALARVWKAERFSWWFTSITHRFPDMDGFA
RRIQAAEIDYIRGSQAAQRTLAENYVGLPLMAA