Protein Info for GFF2373 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: SSU ribosomal protein S14p (S29e) @ SSU ribosomal protein S14p (S29e), zinc-independent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00253: Ribosomal_S14
  • amino acids 47 to 100 (54 residues), 91.9 bits, E=8.2e-31

Best Hits

Swiss-Prot: 100% identical to RS14_SALPB: 30S ribosomal protein S14 (rpsN) from Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)

KEGG orthology group: K02954, small subunit ribosomal protein S14 (inferred from 98% identity to eoi:ECO111_4128)

MetaCyc: 98% identical to 30S ribosomal subunit protein S14 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S14p (S29e) @ SSU ribosomal protein S14p (S29e), zinc-independent"

Protein Sequence (101 amino acids)

>GFF2373 SSU ribosomal protein S14p (S29e) @ SSU ribosomal protein S14p (S29e), zinc-independent (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAKQSMKAREVKRVALADKYFAKRAELKAIISDVNATDEDRWNAVLKLQTLPRDSSPSRQ
RNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW