Protein Info for GFF237 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Diaminopimelate epimerase (EC 5.1.1.7)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00652: diaminopimelate epimerase
  • amino acids 1 to 273 (273 residues), 343.3 bits, E=5.1e-107
• PF01678: DAP_epimerase
  • amino acids 3 to 123 (121 residues), 116.8 bits, E=3.2e-38
  • amino acids 152 to 266 (115 residues), 129.4 bits, E=4e-42

Best Hits

Swiss-Prot: 100% identical to DAPF_SALPK: Diaminopimelate epimerase (dapF) from Salmonella paratyphi A (strain AKU_12601)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 98% identity to cko:CKO_00151)

MetaCyc: 96% identical to diaminopimelate epimerase (Escherichia coli K-12 substr. MG1655)
Diaminopimelate epimerase. [EC: 5.1.1.7]

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.7

Protein Sequence (274 amino acids)

>GFF237 Diaminopimelate epimerase (EC 5.1.1.7) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFHY
RIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDELVRVNMGE
PNFEPAQVPFRANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVDNVDTAAVETLGPVLE
SHERFPERANIGFMQVVRREHIRLRVYERGAGETRACGSGACAAVAVGIQQGLLAEEVRV
ELPGGRLDIAWKGPGHPLYMTGPAAHIYDGFIHL