Protein Info for PS417_12080 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 120 to 148 (29 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details PF03741: TerC" amino acids 15 to 203 (189 residues), 151 bits, see alignment E=4.4e-48 PF00571: CBS" amino acids 384 to 425 (42 residues), 24.2 bits, see alignment 5.3e-09 PF03471: CorC_HlyC" amino acids 442 to 516 (75 residues), 59.2 bits, see alignment E=5.2e-20

Best Hits

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU2615)

Predicted SEED Role

"Membrane protein, TerC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1UWV2 at UniProt or InterPro

Protein Sequence (520 amino acids)

>PS417_12080 membrane protein (Pseudomonas simiae WCS417)
MEWLADPTAWLGLLTLIVLELVLGIDNLVFIAILADKLPPEQRDRARLIGLSLALLMRLG
LLASISWLVTLTQPLFEVFDKSFSGRDLIMLFGGVFLLFKATMELHERLEGHVAQRTGNV
AYAMFWPIVAQIVVLDAVFSLDAVITAVGMVDELAVMMIAVIVSIGLMIVASKPLTRFVN
AHPTVIMLCLGFLMMIGFALTAEGLGFHIPKGYLYAAIGFSILIEVFNQIARSRRKKSAQ
GVLPVRERTAHAVMRLLGGRSLAVEEVGEEVADLLGEPDAAQGPLFDRRERVMISGVLQL
AERPIRTLMTPRAKVDCIDLADDPDSIRLKLMHSSYSRLPLIRNGAVDEPLGFVHKKELL
KEYLAGNEPNLEHLARRAINLLDSFSILNALEQMRQESTHIAFVINEFGDFMGVLSMTDI
LESIAGELPDASEIEGPDIVEEGDGFRANGALNLNLVRQRTGFRATATEDYQTLAGLVMS
LLDRLPVVGDSLEHEGWRLTVAAVEERRVTQVCLTPLPKA