Protein Info for GFF2367 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: LSU ribosomal protein L16p (L10e)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR01164: ribosomal protein uL16" amino acids 2 to 126 (125 residues), 193.7 bits, see alignment E=5.4e-62 PF00252: Ribosomal_L16" amino acids 4 to 131 (128 residues), 169.8 bits, see alignment E=1.4e-54

Best Hits

Swiss-Prot: 100% identical to RL16_SALPC: 50S ribosomal protein L16 (rplP) from Salmonella paratyphi C (strain RKS4594)

KEGG orthology group: K02878, large subunit ribosomal protein L16 (inferred from 98% identity to ecz:ECS88_3700)

MetaCyc: 98% identical to 50S ribosomal subunit protein L16 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L16p (L10e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (136 amino acids)

>GFF2367 LSU ribosomal protein L16p (L10e) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLQPKRTKFRKMHKGRNRGLAAGADVSFGSFGLKAVGRGRLTARQIEAARRAMTRAVKRQ
GKIWIRVFPDKPITEKPLAVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEELAREAFKLA
AAKLPIKTTFVTKTVM