Protein Info for PS417_12055 in Pseudomonas simiae WCS417

Updated annotation (from data): xylitol ABC transporter, substrate-binding component
Rationale: Specifically important for utilizing xylitol.
Original annotation: sugar ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 34 to 286 (253 residues), 189.6 bits, see alignment E=1.2e-59 PF00532: Peripla_BP_1" amino acids 56 to 265 (210 residues), 52.2 bits, see alignment E=9.7e-18 PF13377: Peripla_BP_3" amino acids 185 to 294 (110 residues), 35.7 bits, see alignment E=1.4e-12

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 86% identity to psb:Psyr_2569)

Predicted SEED Role

"Inositol transport system sugar-binding protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEK0 at UniProt or InterPro

Protein Sequence (335 amino acids)

>PS417_12055 xylitol ABC transporter, substrate-binding component (Pseudomonas simiae WCS417)
MKLGTTLAATAALSLLACSIAMAADGKTYKVGAAVYGLKGQFMQNWVRELKEHPAVKDGT
VQLTVFDGNYDALTQNNQIENMVTQRYDAILFVPIDTKAGVGTVKAAMSNDVVVIASNTK
VADASVPYVGNDDVEGGRLQAQAMVDKLNGKGNVVIIQGPIGQSAQIDREKGELEVLGKH
PDIKIIEKKTANWDRAQALALTEDWLNAHPKGINGVIAQNDDMALGAVQALKSHGLTSKD
VPVTSIDGMPDAIQAAKKDEVTTFLQDAQAQSQGALDVALRALAGKDYKPQSVIWERYAK
EVKWGDGTAKNYILPWVPVTNANADALYKQVSGGK