Protein Info for PS417_12050 in Pseudomonas simiae WCS417

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF23441: SDR" amino acids 12 to 247 (236 residues), 46.5 bits, see alignment E=6.6e-16 PF00106: adh_short" amino acids 15 to 200 (186 residues), 165 bits, see alignment E=3e-52 PF08659: KR" amino acids 17 to 167 (151 residues), 35.9 bits, see alignment E=1.5e-12 PF13561: adh_short_C2" amino acids 21 to 249 (229 residues), 202.4 bits, see alignment E=1.7e-63

Best Hits

Swiss-Prot: 55% identical to GOLD_LISIN: NAD-dependent glycerol dehydrogenase (golD) from Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

KEGG orthology group: K00065, 2-deoxy-D-gluconate 3-dehydrogenase [EC: 1.1.1.125] (inferred from 88% identity to psb:Psyr_2568)

MetaCyc: 51% identical to D-threitol dehydrogenase (Mycolicibacterium smegmatis)
ERYTHRULOSE-REDUCTASE-RXN [EC: 1.1.1.403]

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.125 or 1.1.1.140 or 1.1.1.403

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U140 at UniProt or InterPro

Protein Sequence (251 amino acids)

>PS417_12050 short-chain dehydrogenase (Pseudomonas simiae WCS417)
MSGFWNQAFDLTGHCAVITGGAAGIGLACASLLVERGARVALLDRDPAVVEVAAGLGAGH
LGIAVDLGQIGQIQHTIDTVFAHFQRLDYLINSAGVVLLDKAVDVSESAWDTTLDINLKA
SFFVAQACARHMLAQGSGRIVNLASQAAVIGLDRHVAYCASKAAIVGMTKVLAMEWAPQI
NVNAISPTIVETALGKKAWAGEVGEKAKLQIPAGRFAQPEEIAGLALYLLSDAAQMITGA
NMVIDGGYSIQ