Protein Info for GFF2352 in Sphingobium sp. HT1-2

Annotation: Ribosome-binding factor A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 TIGR00082: ribosome-binding factor A" amino acids 12 to 118 (107 residues), 77.2 bits, see alignment E=7.3e-26 PF02033: RBFA" amino acids 12 to 117 (106 residues), 97.2 bits, see alignment E=3.3e-32

Best Hits

Swiss-Prot: 85% identical to RBFA_SPHAL: Ribosome-binding factor A (rbfA) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K02834, ribosome-binding factor A (inferred from 91% identity to sjp:SJA_C1-16210)

Predicted SEED Role

"Ribosome-binding factor A" in subsystem NusA-TFII Cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>GFF2352 Ribosome-binding factor A (Sphingobium sp. HT1-2)
MSAQQSEGPSVRLLRVGEQVRHVLSDILQRGDVHDDVLSQHVVSVTEVRMSPDLRHATVF
IKSLLGKDEEAVLKALRTNTAYLQREVAHRIRLKYAAKLKFLSDESFDEGSHIDKLLRDP
KVARDLEQDDGED