Protein Info for GFF2351 in Variovorax sp. SCN45

Annotation: Outer membrane lipoprotein component of lipoprotein transport system LolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details PF03550: LolB" amino acids 51 to 162 (112 residues), 54 bits, see alignment E=1e-18

Best Hits

KEGG orthology group: K02494, outer membrane lipoprotein LolB (inferred from 83% identity to vpe:Varpa_4996)

Predicted SEED Role

"putative outer membrane lipoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>GFF2351 Outer membrane lipoprotein component of lipoprotein transport system LolB (Variovorax sp. SCN45)
MRLAGALAPQQIDHGRRVLLAAGGAALLLVAGCAQLSGGGASAPKTSDSWSGRMSLRIES
EPVQTFAALFELRGSADSGDLTLTTPIGSTLAQLHWSPGEALLKDGNNTRRFDSVDALIE
AATGAAIPVGALFGWLAGRNDPVPGWKPDLGQLANGRLAAVREAPSPRADLRIVFERS