Protein Info for GFF2351 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: tRNA (uracil(54)-C5)-methyltransferase (EC 2.1.1.35)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR02143: tRNA (uracil(54)-C(5))-methyltransferase" amino acids 10 to 365 (356 residues), 625.3 bits, see alignment E=1.4e-192 PF05958: tRNA_U5-meth_tr" amino acids 10 to 365 (356 residues), 646.2 bits, see alignment E=1.3e-198

Best Hits

Swiss-Prot: 100% identical to TRMA_SALG2: tRNA/tmRNA (uracil-C(5))-methyltransferase (trmA) from Salmonella gallinarum (strain 287/91 / NCTC 13346)

KEGG orthology group: K00557, tRNA (uracil-5-)-methyltransferase [EC: 2.1.1.35] (inferred from 99% identity to see:SNSL254_A4460)

MetaCyc: 94% identical to tRNA m5U54 methyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA (uracil-5-)-methyltransferase. [EC: 2.1.1.35]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>GFF2351 tRNA (uracil(54)-C5)-methyltransferase (EC 2.1.1.35) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTPEHLPTEQYEAQLAEKVARLQSMMAPFSGLVPEVFRSPVSHYRMRAEFRLWHDGDDLY
HIMFDQQTKSRIRVDTFPAASQLINTLMKAMIAGVRDNHALRHKLFQIDYLTTLSNQAVV
SLLYHKKLDEEWREAATALRDALRAQGLNVHLIGRATKTKIELDQDYIDERLPVAGKEMI
YRQVENSFTQPNAAMNIQMLEWALEVTKDSKGDLLELYCGNGNFSLALARNFNRVLATEI
AKPSVAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREFNRLQGIDLKRYQCETIFVDP
PRSGLDSETEKMVQAYPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECG
VLLTAR