Protein Info for GFF2349 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Unsaturated fatty acid biosythesis repressor FabR, TetR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF00440: TetR_N" amino acids 22 to 58 (37 residues), 33.9 bits, see alignment 2.2e-12 PF21943: TetR_C_46" amino acids 87 to 186 (100 residues), 45.5 bits, see alignment E=8e-16

Best Hits

Swiss-Prot: 100% identical to FABR_SALCH: HTH-type transcriptional repressor FabR (fabR) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: None (inferred from 98% identity to ect:ECIAI39_3026)

Predicted SEED Role

"Unsaturated fatty acid biosythesis repressor FabR, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>GFF2349 Unsaturated fatty acid biosythesis repressor FabR, TetR family (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MGVRAQQKEKTRRSLVEAAFSQLSAERSFASLSLREVAREAGIAPTSFYRHFRDVDELGL
TMVDESGLMLRQLMRQARQRIAKGGSVIRTSVSTFMEFIGNNPNAFRLLLRERSGTSAAF
RAAVAREIQHFIAELADYLELENHMPRAFTEAQAEAMVTIVFSAGAEALDIGAEQRRQLE
ERLVLQLRMIAKGAYYWYRREQEKIAHHSE