Protein Info for GFF2348 in Methylophilus sp. DMC18

Annotation: DNA primase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 TIGR01391: DNA primase" amino acids 1 to 413 (413 residues), 483.4 bits, see alignment E=2.8e-149 PF01807: Zn_ribbon_DnaG" amino acids 3 to 97 (95 residues), 134.4 bits, see alignment E=3.1e-43 PF08275: DNAG_N" amino acids 125 to 247 (123 residues), 144.3 bits, see alignment E=6.6e-46 PF13662: Toprim_4" amino acids 256 to 319 (64 residues), 53.9 bits, see alignment E=5.2e-18 PF01751: Toprim" amino acids 257 to 327 (71 residues), 48.7 bits, see alignment E=2e-16 PF13155: Toprim_2" amino acids 259 to 345 (87 residues), 57.4 bits, see alignment E=4.8e-19 PF10410: DnaB_bind" amino acids 365 to 418 (54 residues), 38.5 bits, see alignment 3.4e-13

Best Hits

KEGG orthology group: K02316, DNA primase [EC: 2.7.7.-] (inferred from 72% identity to mmb:Mmol_2063)

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (579 amino acids)

>GFF2348 DNA primase (Methylophilus sp. DMC18)
MIPESFIQELLNRVDIVDVIDKSVPLKKAGANYSACCPFHNEKSPSFTVSPTKQFYHCFG
CGAHGSALSFLMEYNGLSFVEAVHDLAKQVGMIVPQEQRDPNQPAPTSKAVLLSLQETLQ
QAANYYKAELKKSPRAIDYLKARGLSGQVAAKFQIGYAPAGWQNLQTVFPQYDAEPLETA
GLVVQNEQGRRYDRFRDRIMFPIHNQKGEVIGFGGRVINPEDSPKYYNSPETPVFQKGHE
LYGLFMARRAIRDAGRVLVVEGYMDVVALAQYGIEYAVAALGTATTPFHIAKLMRQTDEI
VFSFDGDKAGRTAAWRAVMNALPAIKDGLKLRFLFLPAEHDPDSFVREFGKEAFEAEMNQ
AMPLSQYIIQHLSERNPLASQEDKVQFLNDAEPILKQIQAPRYAMLLRKKVAEMTGLAQG
EMQRMLKLPNTAKAKEKAVRQRSRTPLSLHLRLALMLLMRPQWAQAALLEQVAGESDEAQ
MLRVVLKAAIAKPESRPVVLLQMIAPYISESLRHQLQRELSLLDESLDFTLEFEGACTQL
SDMAVTARENSLLGQLTEKPFSMLSEAEREALRQLTSKR