Protein Info for GFF2341 in Variovorax sp. SCN45

Annotation: ABC transporter, ATP-binding protein (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF00005: ABC_tran" amino acids 37 to 188 (152 residues), 125.2 bits, see alignment E=3e-40 PF08352: oligo_HPY" amino acids 240 to 268 (29 residues), 28.3 bits, see alignment (E = 1.8e-10)

Best Hits

Swiss-Prot: 48% identical to OPPF_BACSU: Oligopeptide transport ATP-binding protein OppF (oppF) from Bacillus subtilis (strain 168)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 91% identity to vap:Vapar_4353)

MetaCyc: 37% identical to putrescine ABC exporter ATP binding protein SapF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-328 [EC: 7.6.2.16]

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>GFF2341 ABC transporter, ATP-binding protein (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MSEKTAAPPLLQVTDLVRHYALPREKLFGPPPTVKALNGVSFEVQAGKSVGIVGESGSGK
STIARLVMALDTPTSGSVRLEGRDLHTLPKAELRTARRDFQMVFQDPYGSLDPRQTVARI
VAEPLEALAETSRAEQRERASEALAAVGLRTTDMDKYPHEFSGGQRQRIAIARALITRPK
LIVADEPVSALDVSVQAQVLNLMQDLQQQFGISYLLISHDLAVVNHLCDEVCVVWKGKIV
EQGQPSELFQHAQHPYTRTLLEAVPRTPAGGTLLQA