Protein Info for GFF234 in Xanthobacter sp. DMC5

Annotation: 3-dehydroquinate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF01220: DHquinase_II" amino acids 5 to 139 (135 residues), 194.3 bits, see alignment E=3.8e-62 TIGR01088: 3-dehydroquinate dehydratase, type II" amino acids 5 to 140 (136 residues), 186.4 bits, see alignment E=9.9e-60

Best Hits

Swiss-Prot: 79% identical to AROQ_AZOC5: 3-dehydroquinate dehydratase (aroQ) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K03786, 3-dehydroquinate dehydratase II [EC: 4.2.1.10] (inferred from 92% identity to xau:Xaut_3500)

MetaCyc: 57% identical to periplasmic dehydroquinate dehydratase (Gluconobacter oxydans)
3-dehydroquinate dehydratase. [EC: 4.2.1.10]

Predicted SEED Role

"3-dehydroquinate dehydratase II (EC 4.2.1.10)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Quinate degradation (EC 4.2.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.10

Use Curated BLAST to search for 4.2.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>GFF234 3-dehydroquinate dehydratase (Xanthobacter sp. DMC5)
MTDTVHVLNGPNLNLLGTREPGIYGAATLADVEALCRAEGEALGFDIVFRQTNSEGALVD
FIQAARGARGIVLNAAAYTHTSVALRDAVSAVGVPTIEVHLSNVFAREDFRHHSYLSPVV
RGVICGFGPQSYVLGLRAVAGLPQTP