Protein Info for GFF234 in Variovorax sp. SCN45

Annotation: Protein QmcA (possibly involved in integral membrane quality control)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01145: Band_7" amino acids 24 to 192 (169 residues), 110.5 bits, see alignment E=9.6e-36 PF16200: Band_7_C" amino acids 242 to 302 (61 residues), 70.9 bits, see alignment E=7.4e-24

Best Hits

Swiss-Prot: 50% identical to STML2_HUMAN: Stomatin-like protein 2, mitochondrial (STOML2) from Homo sapiens

KEGG orthology group: None (inferred from 99% identity to vap:Vapar_2736)

Predicted SEED Role

"Putative stomatin/prohibitin-family membrane protease subunit YbbK" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>GFF234 Protein QmcA (possibly involved in integral membrane quality control) (Variovorax sp. SCN45)
MEFSVPLIILVIAIIFISQSVKFVPQQNAWVRERLGKYHGTMTPGPNFLIPFIDRVAYKH
SLKEIPLDVPSQICITRDNTQLQVDGILYFQVTDPMRASYGSSNYIVAVTQLAQTSLRSV
IGKLELDKTFEERDVINAQVVAAIDEAALNWGVKVLRYEIKDLTPPKEILLAMQAQITAE
RGKRALIAASEGRRQEQINIATGEREAFIARSEGEKQAQINNAQGEAAAITAVATATADA
IERVAAAIRQPGGEQAVQLKVAERAVDAYGKVAADSKTTLIVPSNMSETAALIASAMRMV
QAGKPSNPT