Protein Info for GFF2333 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transaldolase (EC 2.2.1.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 TIGR00875: fructose-6-phosphate aldolase" amino acids 1 to 214 (214 residues), 337.8 bits, see alignment E=1.1e-105 PF00923: TAL_FSA" amino acids 3 to 213 (211 residues), 172.8 bits, see alignment E=5.2e-55

Best Hits

Swiss-Prot: 100% identical to FSA_SALEP: Fructose-6-phosphate aldolase (fsa) from Salmonella enteritidis PT4 (strain P125109)

KEGG orthology group: K08314, fructose-6-phosphate aldolase 2 [EC: 4.1.2.-] (inferred from 99% identity to ses:SARI_03548)

MetaCyc: 90% identical to fructose-6-phosphate aldolase 2 (Escherichia coli K-12 substr. MG1655)
4.1.2.-

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.2, 4.1.2.-

Use Curated BLAST to search for 2.2.1.2 or 4.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>GFF2333 Transaldolase (EC 2.2.1.2) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MELYLDTANVAEVERLARIFPIAGVTTNPSIVAASKESIWDVLPRLQNAIGEEGTLFAQT
MSRDAKGMVEEAKRLNNAIPGIVVKIPVTAEGLAAIKLLKKEGIVTLGTAVYSASQGLLA
ALAGAKYVAPYVNRVDAQGGDGIRMVQELQTLLEHHAPDSMVLAASFKTPRQALDCLLAG
CQAITLPLDVAQQMLNTPAVESAIEKFEQDWKNAFGNLNL